Tested Applications
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-84102-5 targets TSEN34 in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag35120 Product name: Recombinant human TSEN34 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 52-165 aa of BC020805 Sequence: LMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSALAAEARETRRQELLEKITEGQAAKKQKLEQASGASSSQEAGSSQAAKEDETSDGQASGEQEEAGPS Predict reactive species |
| Full Name | tRNA splicing endonuclease 34 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 34-36 kDa |
| GenBank Accession Number | BC020805 |
| Gene Symbol | TSEN34 |
| Gene ID (NCBI) | 79042 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9BSV6 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The human tRNA splicing endonuclease consists of a heterotetramer complex formed by the four TSEN proteins, which were identified by homology with their yeast counterparts. TSEN2 and TSEN34 are the catalytic subunits, which form a compound active site, whereas TSEN54 and TSEN15 are structural proteins. (PMID: 27392077)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 TSEN34 antibody CL488-84102-5 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

