CoraLite® Plus 488-conjugated TSEN34 Recombinant monoclonal antibody

• 

  IF Staining of MCF-7 using CL488-84102-5

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CoraLite® Plus 488 TSEN34 antibody (CL488-84102-5, Clone: 241155G4 ) at dilution of 1:200.

TSEN34 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84102-5

Clone No.241155G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

241155G4, EC:4.6.1.16, HsSen34, LENG5, PCH2C

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84102-5 targets TSEN34 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35120

  Product name: Recombinant human TSEN34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 52-165 aa of BC020805

  Sequence: LMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSALAAEARETRRQELLEKITEGQAAKKQKLEQASGASSSQEAGSSQAAKEDETSDGQASGEQEEAGPS

• Full Name: tRNA splicing endonuclease 34 homolog (S. cerevisiae)
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34-36 kDa
• GenBank Accession Number: BC020805
• Gene Symbol: TSEN34
• Gene ID (NCBI): 79042
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BSV6
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The human tRNA splicing endonuclease consists of a heterotetramer complex formed by the four TSEN proteins, which were identified by homology with their yeast counterparts. TSEN2 and TSEN34 are the catalytic subunits, which form a compound active site, whereas TSEN54 and TSEN15 are structural proteins. (PMID: 27392077)