Tested Applications
| Positive WB detected in | Saos-2 cells, HEK-293 cells, mouse brain tissue, Neuro-2a cells, pig brain tissue, rat brain tissue, U-251 cells, rabbit brain tissue, PANC-1 cells, MCF-7 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 2 publications below |
Product Information
66434-1-Ig targets GDI1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17511 Product name: Recombinant human GDI1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-209 aa of BC000317 Sequence: MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRI Predict reactive species |
| Full Name | GDP dissociation inhibitor 1 |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC000317 |
| Gene Symbol | GDI1 |
| Gene ID (NCBI) | 2664 |
| RRID | AB_2881804 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P31150 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GDP dissociation inhibitors (GDIs) are proteins that regulate the GDP-GTP exchange reaction of members of the rab family. GDIs can bind and release GDP-bound Rab proteins from membranes. Two GDI proteins towards different Rab proteins have been identified. GDI1 interacts with almost all of the Rab proteins, while GDI2 interacts with Rabll but not Rab3A. GDI1 is expressed primarily in neural and sensory tissues and also in secretory cells, displaying a diffuse, cytoplasmic distribution in cells. It runs as a 55 kDa protein in SDS-PAGE. (PMID: 7929030,PMID: 19570034)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GDI1 antibody 66434-1-Ig | Download protocol |
| IHC protocol for GDI1 antibody 66434-1-Ig | Download protocol |
| WB protocol for GDI1 antibody 66434-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Bioengineered Overexpression of GDP dissociation inhibitor 1 gene associates with the invasiveness and poor outcomes of colorectal cancer | ||
Acta Histochem ECM1-associated miR-1260b promotes osteogenic differentiation by targeting GDI1 | ||
Signal Transduct Target Ther Erianin, a novel dibenzyl compound in Dendrobium extract, inhibits lung cancer cell growth and migration via calcium/calmodulin-dependent ferroptosis. |



















