CoraLite® Plus 488-conjugated GDI1 Monoclonal antibody

GDI1 Monoclonal Antibody for IF/ICC
Cat No. CL488-66434
Clone No.4E1G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF/ICC

OPHN2, RABGDIA, XAP4, MRX41, GDP dissociation inhibitor 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66434 targets GDI1 in IF/ICC applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17511

Product name: Recombinant human GDI1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-209 aa of BC000317

Sequence: MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRI

Predict reactive species
Full Name GDP dissociation inhibitor 1
Calculated Molecular Weight 51 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC000317
Gene Symbol GDI1
Gene ID (NCBI) 2664
RRIDAB_2883336
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP31150
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GDP dissociation inhibitors (GDIs) are proteins that regulate the GDP-GTP exchange reaction of members of the rab family. GDIs can bind and release GDP-bound Rab proteins from membranes. Two GDI proteins towards different Rab proteins have been identified. GDI1 interacts with almost all of the Rab proteins, while GDI2 interacts with Rabll but not Rab3A. GDI1 is expressed primarily in neural and sensory tissues and also in secretory cells, displaying a diffuse, cytoplasmic distribution in cells. It runs as a 55 kDa protein in SDS-PAGE. (PMID: 7929030,PMID: 19570034)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 GDI1 antibody CL488-66434Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...