GDI1 Monoclonal antibody, PBS Only

GDI1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA
Cat No. 66434-1-PBS
Clone No.4E1G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

OPHN2, RABGDIA, XAP4, MRX41, GDP dissociation inhibitor 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66434-1-PBS targets GDI1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17511

Product name: Recombinant human GDI1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-209 aa of BC000317

Sequence: MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRI

Predict reactive species
Full Name GDP dissociation inhibitor 1
Calculated Molecular Weight 51 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC000317
Gene Symbol GDI1
Gene ID (NCBI) 2664
RRIDAB_2881804
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP31150
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GDP dissociation inhibitors (GDIs) are proteins that regulate the GDP-GTP exchange reaction of members of the rab family. GDIs can bind and release GDP-bound Rab proteins from membranes. Two GDI proteins towards different Rab proteins have been identified. GDI1 interacts with almost all of the Rab proteins, while GDI2 interacts with Rabll but not Rab3A. GDI1 is expressed primarily in neural and sensory tissues and also in secretory cells, displaying a diffuse, cytoplasmic distribution in cells. It runs as a 55 kDa protein in SDS-PAGE. (PMID: 7929030,PMID: 19570034)

Loading...
||
New chat Able
正在加载,请稍候...