• Featured Product
  • KD/KO Validated

Caspase 3/P17/P19 Monoclonal antibody

Caspase 3/P17/P19 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66470-2-Ig
Clone No.2G4B2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (5)

Applications

WB, IHC, IF/ICC, ELISA

CASP3, Caspase3, 2G4B2, CASP 3, CASP-3

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HEK-293 cells, NIH/3T3 cells, HepG2 cells, HeLa cells
Positive IHC detected inhuman breast cancer tissue, mouse liver tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:3000
Immunohistochemistry (IHC)IHC : 1:150-1:600
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66470-2-Ig targets Caspase 3/P17/P19 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, canine, chicken, plant
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25029

Product name: Recombinant human CASP3 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 31-176 aa of BC016926

Sequence: ISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDS

Predict reactive species
Full Name caspase 3, apoptosis-related cysteine peptidase
Calculated Molecular Weight 277 aa, 32 kDa
Observed Molecular Weight 32-35 kDa, 19 kDa, 17 kDa
GenBank Accession NumberBC016926
Gene Symbol Caspase 3
Gene ID (NCBI) 836
RRIDAB_2876892
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP42574
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Caspases, a family of endoproteases, are critical players in cell regulatory networks controlling inflammation and cell death. Initiator caspases (caspase-2, -8, -9, -10, -11, and -12) cleave and activate downstream effector caspases (caspase-3, -6, and -7), which in turn execute apoptosis by cleaving targeted cellular proteins. Caspase 3 (also named CPP32, SCA-1, and Apopain) proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at the beginning of apoptosis. Caspase 3 plays a key role in the activation of sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Caspase 3 can also form heterocomplex with other proteins and performs the molecular mass of 50-70 kDa. This antibody can recognize p17, p19 and p32 of Caspase 3.

Protocols

Product Specific Protocols
WB protocol for Caspase 3/P17/P19 antibody 66470-2-IgDownload protocol
IHC protocol for Caspase 3/P17/P19 antibody 66470-2-IgDownload protocol
IF protocol for Caspase 3/P17/P19 antibody 66470-2-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Adv Sci (Weinh)

Mitochondrial tRNAGlu 14693A>G Mutation, an "Enhancer" to the Phenotypic Expression of Leber's Hereditary Optic Neuropathy

Authors - Lihao Jin
rat,mouseWB,IHC

Acta Pharm Sin B

Protocatechuic aldehyde protects cardiomycoytes against ischemic injury via regulation of nuclear pyruvate kinase M2.

Authors - Xunxun Wu
mouseIHC

Biomaterials

Drug-device-field integration for mitochondria-targeting dysfunction and tumor therapy by home-tailored pyroelectric nanocomposites

Authors - Zhe Liu
humanWB

Small

Inherent Capability of Self-Assembling Nanostructures in Specific Proteasome Activation for Cancer Cell Pyroptosis

Authors - Qian-Wei Luo
mouseWB

Nat Commun

BNC1 deficiency-triggered ferroptosis through the NF2-YAP pathway induces primary ovarian insufficiency

Authors - Feixia Wang
ratWB

Acta Biomater

Sodium alginate/collagen/stromal cell-derived factor-1 neural scaffold loaded with BMSCs promotes neurological function recovery after traumatic brain injury.

Authors - Shanshan Ma

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

K. (Verified Customer) (10-26-2023)

This Ab is working good for human, rat and mouse proteins samples.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Human Liver cells
Loading...