Tested Applications
| Positive WB detected in | human testis tissue, human placenta tissue |
| Positive IF-P detected in | mouse stomach tissue, rat lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67226-1-Ig targets DUOX1 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18154 Product name: Recombinant human DUOX1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 614-703 aa of BC114938 Sequence: WIVARLRMRNFKRLQGQDRQSIVSEKLVGGMEALEWQGHKEPCRPVLVYLQPGQIRVVDGRLTVLRTIQLQPPQKVNFVLSSNRGRRTLL Predict reactive species |
| Full Name | dual oxidase 1 |
| Calculated Molecular Weight | 1551 aa, 177 kDa |
| Observed Molecular Weight | 190-200 kDa, 177 kDa, 138 kDa |
| GenBank Accession Number | BC114938 |
| Gene Symbol | DUOX1 |
| Gene ID (NCBI) | 53905 |
| RRID | AB_2882515 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NRD9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DUOX1 (dual oxidase 1) is a calciumactivated transmembrane protein member of the NOX family of NADPH oxidases principally located on the apical surface of airway and thyroid epithelia (PMID: 28982074, 15677770, 10806195). DUOX1 is a strong generator of hydrogen peroxide (H2O2), via intra-molecular dismutation of superoxide (PMID: 25586178). Epithelial DUOX1 appears to participate in additional host defense actions, such as mucociliary clearance, and may contribute to inflammatory responses and epithelial repair processes during exogenous stress (PMID: 19386603). DUOX1 has two isofroms with the calculated molecular mass of 177 and 138 kDa, and apparent molecular mass of 180-200 kDa due to the glycosylation (PMID: 17643428, 19144650).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DUOX1 antibody 67226-1-Ig | Download protocol |
| WB protocol for DUOX1 antibody 67226-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DUOX1 Monoclonal antibody (3B8D6), catalog number 67226-1-Ig, has 4 total citations. These appear in Antioxidants (Basel), Cancers (Basel), Mechanobiol Med, and BMC Mol Cell Biol. The associated research fields include oxidative stress and immune inflammation in rats, papillary thyroid cancer organoid modeling, lipid accumulation in vascular smooth muscle cells, and oxidative stress–induced pyroptosis in heart failure.
| Species | Application | Title |
|---|---|---|
Antioxidants (Basel) Quercetin Attenuates Oxidative Stress and Immune Inflammation via Modulating Heme and ROS Pathways in Rats Fed Protein-Oxidized Soybean Meal. | ||
Cancers (Basel) Patient-Derived Papillary Thyroid Cancer Organoids for Radioactive Iodine Refractory Screening. | ||
Mechanobiol Med Overstretch causes lipid accumulation in vascular smooth muscle cells dependent on NADPH oxidase 1 | ||
BMC Mol Cell Biol Upregulated dual oxidase 1-induced oxidative stress and caspase-1-dependent pyroptosis reflect the etiologies of heart failure |
Reviews
What customers say
One review was submitted for this antibody used in Western Blot and Immunofluorescence on mouse lung samples (dilutions 1:1000 for WB and 1:200 for IF). The reviewer rated it 3 out of 5, noting that the antibody showed limited specificity in both the blot and IF images. Overall, the feedback suggests the antibody may not provide the sharp, specific signal expected for these applications on mouse lung tissue.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Edma (Verified Customer) (03-03-2025) | The antibody is not that specific either in EB or in the IF images
|
