Tested Applications
| Positive WB detected in | human testis tissue, human placenta tissue |
| Positive IF-P detected in | mouse stomach tissue, rat lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IF | See 1 publications below |
Product Information
67226-1-Ig targets DUOX1 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18154 Product name: Recombinant human DUOX1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 614-703 aa of BC114938 Sequence: WIVARLRMRNFKRLQGQDRQSIVSEKLVGGMEALEWQGHKEPCRPVLVYLQPGQIRVVDGRLTVLRTIQLQPPQKVNFVLSSNRGRRTLL Predict reactive species |
| Full Name | dual oxidase 1 |
| Calculated Molecular Weight | 1551 aa, 177 kDa |
| Observed Molecular Weight | 190-200 kDa, 177 kDa, 138 kDa |
| GenBank Accession Number | BC114938 |
| Gene Symbol | DUOX1 |
| Gene ID (NCBI) | 53905 |
| RRID | AB_2882515 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NRD9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DUOX1 (dual oxidase 1) is a calciumactivated transmembrane protein member of the NOX family of NADPH oxidases principally located on the apical surface of airway and thyroid epithelia (PMID: 28982074, 15677770, 10806195). DUOX1 is a strong generator of hydrogen peroxide (H2O2), via intra-molecular dismutation of superoxide (PMID: 25586178). Epithelial DUOX1 appears to participate in additional host defense actions, such as mucociliary clearance, and may contribute to inflammatory responses and epithelial repair processes during exogenous stress (PMID: 19386603). DUOX1 has two isofroms with the calculated molecular mass of 177 and 138 kDa, and apparent molecular mass of 180-200 kDa due to the glycosylation (PMID: 17643428, 19144650).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DUOX1 antibody 67226-1-Ig | Download protocol |
| WB protocol for DUOX1 antibody 67226-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancers (Basel) Patient-Derived Papillary Thyroid Cancer Organoids for Radioactive Iodine Refractory Screening. | ||
BMC Mol Cell Biol Upregulated dual oxidase 1-induced oxidative stress and caspase-1-dependent pyroptosis reflect the etiologies of heart failure | ||
Mechanobiol Med Overstretch causes lipid accumulation in vascular smooth muscle cells dependent on NADPH oxidase 1 |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Edma (Verified Customer) (03-03-2025) | The antibody is not that specific either in EB or in the IF images
|









