DUOX1 Monoclonal antibody, PBS Only

DUOX1 Monoclonal Antibody for WB, IF-P, Indirect ELISA
Cat No. 67226-1-PBS
Clone No.3B8D6

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

3B8D6, DUOX, DUOX 1, EC:1.11.1.-, Large NOX 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67226-1-PBS targets DUOX1 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18154

Product name: Recombinant human DUOX1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 614-703 aa of BC114938

Sequence: WIVARLRMRNFKRLQGQDRQSIVSEKLVGGMEALEWQGHKEPCRPVLVYLQPGQIRVVDGRLTVLRTIQLQPPQKVNFVLSSNRGRRTLL

Predict reactive species
Full Name dual oxidase 1
Calculated Molecular Weight 1551 aa, 177 kDa
Observed Molecular Weight 190-200 kDa, 177 kDa, 138 kDa
GenBank Accession NumberBC114938
Gene Symbol DUOX1
Gene ID (NCBI) 53905
RRIDAB_2882515
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NRD9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DUOX1 (dual oxidase 1) is a calciumactivated transmembrane protein member of the NOX family of NADPH oxidases principally located on the apical surface of airway and thyroid epithelia (PMID: 28982074, 15677770, 10806195). DUOX1 is a strong generator of hydrogen peroxide (H2O2), via intra-molecular dismutation of superoxide (PMID: 25586178). Epithelial DUOX1 appears to participate in additional host defense actions, such as mucociliary clearance, and may contribute to inflammatory responses and epithelial repair processes during exogenous stress (PMID: 19386603). DUOX1 has two isofroms with the calculated molecular mass of 177 and 138 kDa, and apparent molecular mass of 180-200 kDa due to the glycosylation (PMID: 17643428, 19144650).

Loading...
||
New chat Able
正在加载,请稍候...