Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, THP-1 cells, K-562 cells, Jurkat cells, L02 cells, HEK-293 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 5 publications below |
| IP | See 1 publications below |
Product Information
67315-1-Ig targets TRAF2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25387 Product name: Recombinant human TRAF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 438-501 aa of BC032410 Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL Predict reactive species |
| Full Name | TNF receptor-associated factor 2 |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC032410 |
| Gene Symbol | TRAF2 |
| Gene ID (NCBI) | 7186 |
| RRID | AB_2882575 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q12933 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TRAF2 antibody 67315-1-Ig | Download protocol |
| WB protocol for TRAF2 antibody 67315-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Rep Liquidambaric acid inhibits Wnt/β-catenin signaling and colon cancer via targeting TNF receptor-associated factor 2. | ||
Cell Rep KIF26B promotes bladder cancer progression via activating Wnt/β-catenin signaling in a TRAF2-dependent pathway | ||
Aging (Albany NY) Implications of the KHDC4-TRAF2 axis in the context of prostate cancer prognosis
| ||
J Ethnopharmacol Extract of Nanhaia speciosa J. Compton & Schrire alleviates LPS-induced acute lung injury via the NF-κB/Nrf2/AQPs pathway | ||
Int J Biol Macromol Bilobalide ameliorates ovariectomy-induced osteoporosis by influencing SIRT3/NF-κB axis in osteoclast and promoting M2 polarization in macrophages | ||





