Product Information
67315-1-PBS targets TRAF2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25387 Product name: Recombinant human TRAF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 438-501 aa of BC032410 Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL Predict reactive species |
Full Name | TNF receptor-associated factor 2 |
Calculated Molecular Weight | 56 kDa |
Observed Molecular Weight | 53 kDa |
GenBank Accession Number | BC032410 |
Gene Symbol | TRAF2 |
Gene ID (NCBI) | 7186 |
RRID | AB_2882575 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q12933 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |