CoraLite® Plus 488-conjugated TRAF2 Monoclonal antibody

• 

  IF Staining of HeLa using CL488-67315

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 TRAF2 antibody (CL488-67315, Clone: 2A4D1 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL488-67315

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human TRAF2 (CL488-67315, Clone:2A4D1) (red), or 0.4 ug Mouse IgG2a Isotype Control (CL488-66360-2, Clone: K11A1B2A2) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

TRAF2 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-67315

Clone No.2A4D1

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

TRAP3, TRAP, TNF receptor-associated factor 2, RING-type E3 ubiquitin transferase TRAF2, EC:2.3.2.27

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67315 targets TRAF2 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25387

  Product name: Recombinant human TRAF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 438-501 aa of BC032410

  Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL

• Full Name: TNF receptor-associated factor 2
• Calculated Molecular Weight: 56 kDa
• GenBank Accession Number: BC032410
• Gene Symbol: TRAF2
• Gene ID (NCBI): 7186
• RRID: AB_2919450
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q12933
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.