Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67590-1-Ig targets VPS18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Rat samples.
| Tested Reactivity | Human, Rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29954 Product name: Recombinant human VPS18 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 226-355 aa of BC001513 Sequence: QRLFQFIGRAAEGAEAQGFSGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGALDCGRPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVL Predict reactive species |
| Full Name | vacuolar protein sorting 18 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 110 kDa |
| Observed Molecular Weight | 100-110 kDa |
| GenBank Accession Number | BC001513 |
| Gene Symbol | VPS18 |
| Gene ID (NCBI) | 57617 |
| RRID | AB_2882798 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9P253 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Vps18 is a central member of Vps-C complex. Vps18 may play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VPS18 antibody 67590-1-Ig | Download protocol |
| IHC protocol for VPS18 antibody 67590-1-Ig | Download protocol |
| WB protocol for VPS18 antibody 67590-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







