CoraLite® Plus 488-conjugated VPS18 Monoclonal antibody

• 

  IF Staining of A549 using CL488-67590

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using CoraLite® Plus 488 VPS18 antibody (CL488-67590, Clone: 2E10G11 ) at dilution of 1:100.

VPS18 Monoclonal Antibody for IF/ICC

Cat No. CL488-67590

Clone No.2E10G11

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

IF/ICC

Synonyms

hVPS18, KIAA1475, PEP3, VPS18

---

Tested Applications

• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67590 targets VPS18 in IF/ICC applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29954

  Product name: Recombinant human VPS18 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 226-355 aa of BC001513

  Sequence: QRLFQFIGRAAEGAEAQGFSGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGALDCGRPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVL

• Full Name: vacuolar protein sorting 18 homolog (S. cerevisiae)
• Calculated Molecular Weight: 110 kDa
• GenBank Accession Number: BC001513
• Gene Symbol: VPS18
• Gene ID (NCBI): 57617
• RRID: AB_2919503
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9P253
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Vps18 is a central member of Vps-C complex. Vps18 may play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes.