Product Information
67590-1-PBS targets VPS18 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Rat samples.
| Tested Reactivity | Human, Rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29954 Product name: Recombinant human VPS18 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 226-355 aa of BC001513 Sequence: QRLFQFIGRAAEGAEAQGFSGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGALDCGRPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVL Predict reactive species |
| Full Name | vacuolar protein sorting 18 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 110 kDa |
| Observed Molecular Weight | 100-110 kDa |
| GenBank Accession Number | BC001513 |
| Gene Symbol | VPS18 |
| Gene ID (NCBI) | 57617 |
| RRID | AB_2882798 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9P253 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Vps18 is a central member of Vps-C complex. Vps18 may play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes.







