• Featured Product
  • KD/KO Validated

PSME1 Monoclonal antibody

PSME1 Monoclonal Antibody for WB, IF/ICC, ELISA
Cat No. 67928-1-Ig
Clone No.1F7E2

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, IF/ICC, ELISA

IFI5111, IGUP I 5111, PA28A, PA28alpha, PSME1, REG alpha, REGalpha

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMDA-MB-231 cells, Hela cells, HEK-293 cells, Jurkat cells, k-562 cells, HSC-T6 cells, C6 cells, NIH/3T3 cells and 4T1 cells.
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67928-1-Ig targets PSME1 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30549

Product name: Recombinant human PSME1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-249 aa of BC007503

Sequence: MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

Predict reactive species
Full Name proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)
Calculated Molecular Weight 29 kDa
Observed Molecular Weight29 kDa
GenBank Accession NumberBC007503
Gene Symbol PSME1
Gene ID (NCBI) 5720
RRIDAB_2918680
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ06323
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The principal function of the proteasome is targeted degradation of intracellular proteins. Activity of the 20S proteasome is controlled by regulatory complexes that bind to the ends of the cylindrical proteasome. 11S regulator (REG or PA28), is a complex of 28 kDa subunits that is thought to activate proteasomes toward the production of antigenic peptides. Human PSME1 and PSME2 genes encode the two proteasome activators PA28 alpha and beta, respectively, which have been implicated in antigen processing for loading class I MHC molecules. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.

Protocols

Product Specific Protocols
IF protocol for PSME1 antibody 67928-1-IgDownload protocol
WB protocol for PSME1 antibody 67928-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...