• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated PSME1 Monoclonal antibody

PSME1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-67928
Clone No.1F7E2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

1F7E2, IFI5111, IGUP I-5111, Interferon gamma up-regulated I-5111 protein, PA28A

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67928 targets PSME1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30549

Product name: Recombinant human PSME1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-249 aa of BC007503

Sequence: MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

Predict reactive species
Full Name proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)
Calculated Molecular Weight 29 kDa
Observed Molecular Weight29 kDa
GenBank Accession NumberBC007503
Gene Symbol PSME1
Gene ID (NCBI) 5720
RRIDAB_2923934
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ06323
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The principal function of the proteasome is targeted degradation of intracellular proteins. Activity of the 20S proteasome is controlled by regulatory complexes that bind to the ends of the cylindrical proteasome. 11S regulator (REG or PA28), is a complex of 28 kDa subunits that is thought to activate proteasomes toward the production of antigenic peptides. Human PSME1 and PSME2 genes encode the two proteasome activators PA28 alpha and beta, respectively, which have been implicated in antigen processing for loading class I MHC molecules. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.

Protocols

Product Specific Protocols
FC protocol for CL594 PSME1 antibody CL594-67928Download protocol
IF protocol for CL594 PSME1 antibody CL594-67928Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...