Tested Applications
Positive WB detected in | SKOV-3 cells, HT-29 cells, COLO 320 cells, A549 cells |
Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human pancreas cancer tissue |
Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 1 publications below |
Product Information
67990-1-Ig targets MMP7 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0550 Product name: Recombinant human MMP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC003635 Sequence: MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSHVIEIMQKPRCGVPDVAEYSLFPN Predict reactive species |
Full Name | matrix metallopeptidase 7 (matrilysin, uterine) |
Calculated Molecular Weight | 29 kDa |
Observed Molecular Weight | 27-30 kDa |
GenBank Accession Number | BC003635 |
Gene Symbol | MMP7 |
Gene ID (NCBI) | 4316 |
RRID | AB_2918739 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P09237 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MMP7 antibody 67990-1-Ig | Download protocol |
IHC protocol for MMP7 antibody 67990-1-Ig | Download protocol |
IF protocol for MMP7 antibody 67990-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Curr Eye Res Cohesin Complex Interacting with Promoters of MMP Genes for in Pterygium Occurrence | ||
Discov Oncol Tanshinone IIA affects the proliferation of A549/Tax by affecting the expression of MMP7 through the PI3K-AKT-mTOR signaling pathway |