CoraLite®594-conjugated MMP7 Monoclonal antibody

MMP7 Monoclonal Antibody for IF-P
Cat No. CL594-67990
Clone No.2E6D6

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

IF-P

Matrilysin, Matrin, Matrix metalloproteinase 7, MMP 7, MMP7, MPSL1, PUMP 1, Pump 1 protease, PUMP1, Uterine metalloproteinase

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman pancreas cancer tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67990 targets MMP7 in IF-P applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0550

Product name: Recombinant human MMP7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-100 aa of BC003635

Sequence: MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSHVIEIMQKPRCGVPDVAEYSLFPN

Predict reactive species
Full Name matrix metallopeptidase 7 (matrilysin, uterine)
Calculated Molecular Weight 29 kDa
Observed Molecular Weight27-30 kDa
GenBank Accession NumberBC003635
Gene Symbol MMP7
Gene ID (NCBI) 4316
RRIDAB_2923938
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP09237
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Protocols

Product Specific Protocols
IF protocol for CL594 MMP7 antibody CL594-67990Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...