CoraLite®594-conjugated MMP7 Monoclonal antibody

• 

  IF Staining of human pancreas cancer using CL594-67990

  Immunofluorescent analysis of (4% PFA) fixed human pancreas cancer tissue using CoraLite®594 MMP7 antibody (CL594-67990, Clone: 2E6D6 ) at dilution of 1:200.

MMP7 Monoclonal Antibody for IF-P

Cat No. CL594-67990

Clone No.2E6D6

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

IF-P

Synonyms

Matrilysin, Matrin, Matrix metalloproteinase 7, MMP 7, MMP7, MPSL1, PUMP 1, Pump 1 protease, PUMP1, Uterine metalloproteinase

---

Tested Applications

• Positive IF-P detected in: human pancreas cancer tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67990 targets MMP7 in IF-P applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0550

  Product name: Recombinant human MMP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC003635

  Sequence: MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSHVIEIMQKPRCGVPDVAEYSLFPN

• Full Name: matrix metallopeptidase 7 (matrilysin, uterine)
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC003635
• Gene Symbol: MMP7
• Gene ID (NCBI): 4316
• RRID: AB_2923938
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09237
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.