Tested Applications
Positive IF-P detected in | human pancreas cancer tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-67990 targets MMP7 in IF-P applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0550 Product name: Recombinant human MMP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC003635 Sequence: MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSHVIEIMQKPRCGVPDVAEYSLFPN Predict reactive species |
Full Name | matrix metallopeptidase 7 (matrilysin, uterine) |
Calculated Molecular Weight | 29 kDa |
Observed Molecular Weight | 27-30 kDa |
GenBank Accession Number | BC003635 |
Gene Symbol | MMP7 |
Gene ID (NCBI) | 4316 |
RRID | AB_2923851 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P09237 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 MMP7 antibody CL488-67990 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |