Product Information
67990-1-PBS targets MMP7 as part of a matched antibody pair:
MP50369-1: 67990-2-PBS capture and 67990-1-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0550 Product name: Recombinant human MMP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC003635 Sequence: MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSHVIEIMQKPRCGVPDVAEYSLFPN Predict reactive species |
Full Name | matrix metallopeptidase 7 (matrilysin, uterine) |
Calculated Molecular Weight | 29 kDa |
Observed Molecular Weight | 27-30 kDa |
GenBank Accession Number | BC003635 |
Gene Symbol | MMP7 |
Gene ID (NCBI) | 4316 |
RRID | AB_2918739 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P09237 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |