PTPRH Monoclonal antibody

PTPRH Monoclonal Antibody for WB, IF/ICC, ELISA
Cat No. 68635-1-Ig
Clone No.3C6E8

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IF/ICC, ELISA

3C6E8, R PTP H, SAP 1, SAP1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig spleen tissue, A431 cells
Positive IF/ICC detected inHT-29 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68635-1-Ig targets PTPRH in WB, IF/ICC, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17351

Product name: Recombinant human PTPRH protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 378-727 aa of BC111716

Sequence: ETRNATTAPNPVRNLHMETQTNSSIALCWEVPDGPYPQDYTYWVEYTGDGGGTETRNTTNTSVTAERLEPGTLYTFSVWAEKNGARGSRQNVSISTVPNAVTSLSKQDWTNSTIALRWTAPQGPGQSSYSYWVSWVREGMTDPRTQSTSGTDITLKELEAGSLYHLTVWAERNEVRGYNSTLTAATAPNEVTDLQNETQTKNSVMLWWKAPGDPHSQLYVYWVQWASKGHPRRGQDPQANWVNQTSRTNETWYKVEALEPGTLYNFTVWAERNDVASSTQSLCASTYPDTVTITSCVSTSAGYGVNLIWSCPQGGYEAFELEVGGQRGSQDRSSCGEAVSVLGLGPARSY

Predict reactive species
Full Name protein tyrosine phosphatase, receptor type, H
Calculated Molecular Weight 1115 aa, 122 kDa
Observed Molecular Weight200-210 kDa
GenBank Accession NumberBC111716
Gene Symbol PTPRH
Gene ID (NCBI) 5794
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9HD43
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTPRH, also known as SAP-1 (Stomach Cancer-Associated Protein-Tyrosine Phosphatase-1), is a member of the protein tyrosine phosphatase (PTP) family. These enzymes regulate cellular signaling by dephosphorylating tyrosine residues on proteins, counterbalancing kinase activity (PMID: 11278335). PTPRH is classified as a receptor-type PTP, characterized by an extracellular domain, a transmembrane region, and intracellular catalytic domains. In colorectal, gastric, and hepatocellular cancers, PTPRH is often upregulated and linked to poor prognosis (PMID: 12101188). Paradoxically, it may suppress tumorigenesis in other contexts by stabilizing cell adhesion. Overexpression in certain cancers suggests utility as a diagnostic or prognostic marker. The molecular weight of PTPRH is 122 kDa, it is reported that it can form a dimer with a molecular weight of 210 kDa (PMID:15850787).

Protocols

Product Specific Protocols
WB protocol for PTPRH antibody 68635-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...