Tested Applications
Positive WB detected in | mouse cerebellum tissue, mouse brain tissue, rat brain tissue |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
83057-2-RR targets GABRA2 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag29301 Product name: Recombinant human GABRA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 348-412 aa of NM_000807 Sequence: SVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFN Predict reactive species |
Full Name | gamma-aminobutyric acid (GABA) A receptor, alpha 2 |
Calculated Molecular Weight | 51 kDa |
Observed Molecular Weight | 50-51 kDa |
GenBank Accession Number | NM_000807 |
Gene Symbol | GABRA2 |
Gene ID (NCBI) | 2555 |
RRID | AB_3670783 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P47869 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GABRA2 (gamma-aminobutyric acid type A receptor subunit alpha2), also known as DEE78. It is expected to be located in cell membrane, and the protein is highly expressed in brain. The protein is a ligand-gated chloride channel, which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain (PubMed:29961870). It also plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel (PubMed:29961870). The calculated molecular weight of GABRA2 is 51 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GABRA2 antibody 83057-2-RR | Download protocol |
FC protocol for GABRA2 antibody 83057-2-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Ethnopharmacol Flavonoids from mulberry leaves exhibit sleep-improving effects via regulating GABA and 5-HT receptors | ||
Int Immunopharmacol Promotion of sleep by cinnamic acid in parachlorophenylalanine-induced insomnia in rats |