CoraLite® Plus 750-conjugated GABRA2 Recombinant monoclonal antibody

GABRA2 Uni-rAb® Recombinant Antibody for WB, FC (Intra)
Cat No. CL750-83057-2
Clone No.230158E6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra)

230158E6, GABA(A) receptor subunit alpha-2, GABAAR subunit alpha-2, Gamma-aminobutyric acid receptor subunit alpha-2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inunboiled rat brain tissue, unboiled mouse brain tissue, mouse cerebellum tissue
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-83057-2 targets GABRA2 in WB, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29301

Product name: Recombinant human GABRA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 348-412 aa of NM_000807

Sequence: SVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFN

Predict reactive species
Full Name gamma-aminobutyric acid (GABA) A receptor, alpha 2
Calculated Molecular Weight 51 kDa
Observed Molecular Weight50-51 kDa
GenBank Accession NumberNM_000807
Gene Symbol GABRA2
Gene ID (NCBI) 2555
RRIDAB_3673764
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP47869
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GABRA2 (gamma-aminobutyric acid type A receptor subunit alpha2), also known as DEE78. It is expected to be located in cell membrane, and the protein is highly expressed in brain. The protein is a ligand-gated chloride channel, which is a component of the heteropentameric receptor for GABA, the major inhibitory neurotransmitter in the brain (PubMed:29961870). It also plays an important role in the formation of functional inhibitory GABAergic synapses in addition to mediating synaptic inhibition as a GABA-gated ion channel (PubMed:29961870). The calculated molecular weight of GABRA2 is 51 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 750 GABRA2 antibody CL750-83057-2Download protocol
WB protocol for CL Plus 750 GABRA2 antibody CL750-83057-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...