SLC16A11 Recombinant monoclonal antibody, PBS Only (Detector)

SLC16A11 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83239-2-PBS
Clone No.240081G10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

FLJ90193, MCT 11, MCT11, Monocarboxylate transporter 11

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83239-2-PBS targets SLC16A11 as part of a matched antibody pair:

MP00223-1: 83239-3-PBS capture and 83239-2-PBS detection (validated in Cytometric bead array)

MP00223-2: 83239-1-PBS capture and 83239-2-PBS detection (validated in Cytometric bead array)

MP00223-3: 83239-4-PBS capture and 83239-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24920

Product name: Recombinant human SLC16A11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 397-471 aa of BC093860

Sequence: FLRDETGDFTASFLLSGSLILSGSFIYIGLPRALPSCGPASPPATPPPETGELLPAPQAVLLSPGGPGSTLDTTC

Predict reactive species
Full Name solute carrier family 16, member 11 (monocarboxylic acid transporter 11)
Calculated Molecular Weight 471 aa, 48 kDa
GenBank Accession NumberBC093860
Gene Symbol SLC16A11
Gene ID (NCBI) 162515
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8NCK7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...