Tested Applications
| Positive WB detected in | Caco-2 cells, human liver tissue |
| Positive FC (Intra) detected in | Caco-2 cells, U-251 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83346-6-RR targets SLC38A7 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag35081 Product name: Recombinant human SLC38A7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC001961 Sequence: MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTST Predict reactive species |
| Full Name | solute carrier family 38, member 7 |
| Calculated Molecular Weight | 50 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC001961 |
| Gene Symbol | SLC38A7 |
| Gene ID (NCBI) | 55238 |
| RRID | AB_3671005 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q9NVC3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC38A7 also known as SNAT7, is a member of the SLC38 family that encodes sodium-coupled neutral amino acid transporters. SLC38A7 is a system N transporter that has a substrate preference for L-glutamine. It also transports other amino acids with polar side chains, as well as L-histidine and L-alanine (PMID: 21511949).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SLC38A7 antibody 83346-6-RR | Download protocol |
| WB protocol for SLC38A7 antibody 83346-6-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









