SLC38A7 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of Caco-2 using 83346-6-RR (same clone as 83346-6-PBS)

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 83346-6-RR (SLC38A7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83346-6-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 83346-6-RR (same clone as 83346-6-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 83346-6-RR (SLC38A7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83346-6-PBS in a different storage buffer formulation.

• 

  FC experiment of Caco-2 using 83346-6-RR (same clone as 83346-6-PBS)

  1x10^6 Caco-2 cells were intracellularly stained with 0.25 ug SLC38A7 Recombinant antibody (83346-6-RR, Clone:240147C3) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83346-6-PBS in a different storage buffer formulation.

• 

  FC experiment of U-251 using 83346-6-RR (same clone as 83346-6-PBS)

  1x10^6 U-251 cells were intracellularly stained with 0.25 ug SLC38A7 Recombinant antibody (83346-6-RR, Clone:240147C3) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83346-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83346-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83346-6-RR against Human SLC38A7 were performed. The affinity constant is 1.31 nM.

SLC38A7 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83346-6-PBS

Clone No.240147C3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

SNAT7, 240147C3, FLJ10815, FLJ12724, Sodium-coupled neutral amino acid transporter 7

---

Product Information

83346-6-PBS targets SLC38A7 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35081

  Product name: Recombinant human SLC38A7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-53 aa of BC001961

  Sequence: MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTST

• Full Name: solute carrier family 38, member 7
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC001961
• Gene Symbol: SLC38A7
• Gene ID (NCBI): 55238
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9NVC3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC38A7 also known as SNAT7, is a member of the SLC38 family that encodes sodium-coupled neutral amino acid transporters. SLC38A7 is a system N transporter that has a substrate preference for L-glutamine. It also transports other amino acids with polar side chains, as well as L-histidine and L-alanine (PMID: 21511949).