Product Information
83346-6-PBS targets SLC38A7 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag35081 Product name: Recombinant human SLC38A7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC001961 Sequence: MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTST Predict reactive species |
| Full Name | solute carrier family 38, member 7 |
| Calculated Molecular Weight | 50 kDa |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC001961 |
| Gene Symbol | SLC38A7 |
| Gene ID (NCBI) | 55238 |
| RRID | AB_3671005 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q9NVC3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC38A7 also known as SNAT7, is a member of the SLC38 family that encodes sodium-coupled neutral amino acid transporters. SLC38A7 is a system N transporter that has a substrate preference for L-glutamine. It also transports other amino acids with polar side chains, as well as L-histidine and L-alanine (PMID: 21511949).









