Tested Applications
| Positive WB detected in | HeLa cells, MCF-7 cells, HT-29 cells, HEK-293T cells, mouse ovary tissue, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue |
| Positive IF/ICC detected in | A431 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:150-1:600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83822-2-RR targets COPS3 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag32825 Product name: Recombinant human COPS3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 270-423 aa of BC001891 Sequence: NNPSELRNLVNKHSETFTRDNNMGLVKQCLSSLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS Predict reactive species |
| Full Name | COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis) |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 46 kDa |
| GenBank Accession Number | BC001891 |
| Gene Symbol | COPS3 |
| Gene ID (NCBI) | 8533 |
| RRID | AB_3671406 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UNS2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COPS3 possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for COPS3 antibody 83822-2-RR | Download protocol |
| IHC protocol for COPS3 antibody 83822-2-RR | Download protocol |
| WB protocol for COPS3 antibody 83822-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













