• Featured Product
  • KD/KO Validated

COPS3 Recombinant monoclonal antibody, PBS Only (Detector)

COPS3 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 83822-2-PBS
Clone No.240918E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

240918E3, COP 9 signalosome complex subunit 3, JAB1-containing signalosome subunit 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83822-2-PBS targets COPS3 as part of a matched antibody pair:

MP00797-1: 83822-4-PBS capture and 83822-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag32825

Product name: Recombinant human COPS3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 270-423 aa of BC001891

Sequence: NNPSELRNLVNKHSETFTRDNNMGLVKQCLSSLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS

Predict reactive species
Full Name COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis)
Calculated Molecular Weight 48 kDa
Observed Molecular Weight46 kDa
GenBank Accession NumberBC001891
Gene Symbol COPS3
Gene ID (NCBI) 8533
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UNS2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

COPS3 possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Loading...
||
New chat Able
正在加载,请稍候...