Tested Applications
| Positive WB detected in | MCF-7 cells, mouse testis tissue, C6 cells, mouse spleen tissue, mouse brain tissue, rat brain tissue |
| Positive FC (Intra) detected in | HepG2 cells, A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83917-2-RR targets NUCB2/nesfatin-1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25152 Product name: Recombinant human NUCB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-106 aa of NM_005013 Sequence: VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL Predict reactive species |
| Full Name | nucleobindin 2 |
| Calculated Molecular Weight | 50 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | NM_005013 |
| Gene Symbol | NUCB2 |
| Gene ID (NCBI) | 4925 |
| RRID | AB_3671495 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P80303 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NucB2, an anorexigenic molecule, is expressed mainly in the hypothalamus, particularly in the supraoptic nucleus (SON) and the paraventricular nucleus (PVN). NucB2 is also expressed in the subfornical organ (SFO). Because the SON and PVN are involved in body fluid regulation, NucB2 may be involved in dehydration-induced anorexia. NUCB2 is composed of a signal peptide of 24 amino acids in the N-terminal region and a protin structure containing 396 amino acids. Nesfatin-1 is an 82-amino-acid peptide hormone cleaved from nucleobindin2 (NUCB2).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NUCB2/nesfatin-1 antibody 83917-2-RR | Download protocol |
| WB protocol for NUCB2/nesfatin-1 antibody 83917-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









