NUCB2/nesfatin-1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83917-2-RR (same clone as 83917-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83917-2-RR (NUCB2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83917-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 83917-2-RR (same clone as 83917-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83917-2-RR (NUCB2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83917-2-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 83917-2-RR (same clone as 83917-2-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug NUCB2/nesfatin-1 Recombinant antibody (83917-2-RR, Clone:241037D8) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 83917-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 83917-2-RR (same clone as 83917-2-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug NUCB2/nesfatin-1 Recombinant antibody (83917-2-RR, Clone:241037D8) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 83917-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83917-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83917-2-RR against Human NUCB2/nesfatin-1 were performed. The affinity constant is 8.99 nM.

NUCB2/nesfatin-1 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83917-2-PBS

Clone No.241037D8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

NUCB2, 241037D8, DNA binding protein NEFA, Gastric cancer antigen Zg4, NEFA

---

Product Information

83917-2-PBS targets NUCB2/nesfatin-1 in WB, FC (Intra), Cytometric bead array, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25152

  Product name: Recombinant human NUCB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-106 aa of NM_005013

  Sequence: VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL

• Full Name: nucleobindin 2
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: NM_005013
• Gene Symbol: NUCB2
• Gene ID (NCBI): 4925
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P80303
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NucB2, an anorexigenic molecule, is expressed mainly in the hypothalamus, particularly in the supraoptic nucleus (SON) and the paraventricular nucleus (PVN). NucB2 is also expressed in the subfornical organ (SFO). Because the SON and PVN are involved in body fluid regulation, NucB2 may be involved in dehydration-induced anorexia. NUCB2 is composed of a signal peptide of 24 amino acids in the N-terminal region and a protin structure containing 396 amino acids. Nesfatin-1 is an 82-amino-acid peptide hormone cleaved from nucleobindin2 (NUCB2).