Product Information
83917-2-PBS targets NUCB2/nesfatin-1 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25152 Product name: Recombinant human NUCB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-106 aa of NM_005013 Sequence: VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL Predict reactive species |
| Full Name | nucleobindin 2 |
| Calculated Molecular Weight | 50 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | NM_005013 |
| Gene Symbol | NUCB2 |
| Gene ID (NCBI) | 4925 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P80303 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
NucB2, an anorexigenic molecule, is expressed mainly in the hypothalamus, particularly in the supraoptic nucleus (SON) and the paraventricular nucleus (PVN). NucB2 is also expressed in the subfornical organ (SFO). Because the SON and PVN are involved in body fluid regulation, NucB2 may be involved in dehydration-induced anorexia. NUCB2 is composed of a signal peptide of 24 amino acids in the N-terminal region and a protin structure containing 396 amino acids. Nesfatin-1 is an 82-amino-acid peptide hormone cleaved from nucleobindin2 (NUCB2).









