Mouse Atox1 Recombinant monoclonal antibody, PBS Only (Capture)

Atox1 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84305-1-PBS
Clone No.241566A7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

241566A7, Atx1, HAH1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84305-1-PBS targets Atox1 as part of a matched antibody pair:

MP01193-1: 84305-1-PBS capture and 84305-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35290

Product name: Recombinant mouse Atox1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-68 aa of NM_009720

Sequence: MPKHEFSVDMTCEGCAEAVSRVLNKLGGVEFNIDLPNKKVCIDSEHSSDTLLATLNKTGKAVSYLGPK

Predict reactive species
Full Name ATX1 (antioxidant protein 1) homolog 1 (yeast)
Calculated Molecular Weight7 kDa
Observed Molecular Weight7 kDa
GenBank Accession NumberNM_009720
Gene Symbol Atox1
Gene ID (NCBI) 11927
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO08997
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Antioxidant 1 copper chaperone (Atox1) is a small cytosolic protein containing an MBS (metal binding site) and a potential NLS (nuclear localisation signal). It plays an essential role in copper homeostasis by facilitating the transfer of copper to the trans-Golgi. Atox1 has been implicated in a wide range of diseases, including many neurodegenerative, cancer and metabolic disorders.

Loading...
||
New chat Able
正在加载,请稍候...