Product Information
84305-1-PBS targets Atox1 as part of a matched antibody pair:
MP01193-1: 84305-1-PBS capture and 84305-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag35290 Product name: Recombinant mouse Atox1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-68 aa of NM_009720 Sequence: MPKHEFSVDMTCEGCAEAVSRVLNKLGGVEFNIDLPNKKVCIDSEHSSDTLLATLNKTGKAVSYLGPK Predict reactive species |
Full Name | ATX1 (antioxidant protein 1) homolog 1 (yeast) |
Calculated Molecular Weight | 7 kDa |
Observed Molecular Weight | 7 kDa |
GenBank Accession Number | NM_009720 |
Gene Symbol | Atox1 |
Gene ID (NCBI) | 11927 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O08997 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Antioxidant 1 copper chaperone (Atox1) is a small cytosolic protein containing an MBS (metal binding site) and a potential NLS (nuclear localisation signal). It plays an essential role in copper homeostasis by facilitating the transfer of copper to the trans-Golgi. Atox1 has been implicated in a wide range of diseases, including many neurodegenerative, cancer and metabolic disorders.