Product Information
84340-2-PBS targets ORAI3 as part of a matched antibody pair:
MP01228-1: 84340-3-PBS capture and 84340-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag36135 Product name: Recombinant human ORAI3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC006126 Sequence: MKGGEGDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAKLKASSRTSALLSGFAMVAMVEVQLESDHEYPPGLLVAFSA Predict reactive species |
Full Name | ORAI calcium release-activated calcium modulator 3 |
Calculated Molecular Weight | 295 aa, 32 kDa |
Observed Molecular Weight | ~30 kDa,~60 kDa |
GenBank Accession Number | BC006126 |
Gene Symbol | ORAI3 |
Gene ID (NCBI) | 93129 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9BRQ5 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
ORAI3, also named TMEM142C, is a key regulator or component of store-operated Ca2+ channels and transcription factor NFAT nuclear import. ORAI3 channels appeared to differ from Orai1 and -2 in being somewhat resistant to Ca2+ depotentiation. The molecular weight of monomers and dimers for Orai3 is about 30-35 kDa and 60-70 kDa (PMID: 20971921; 17293345; 22580508).