EPPK1 Recombinant monoclonal antibody, PBS Only (Detector)

EPPK1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 84344-2-PBS
Clone No.241633B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

EPPK, 241633B5, EPIPL, EPIPL1, Epiplakin

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84344-2-PBS targets EPPK1 as part of a matched antibody pair:

MP01220-1: 84344-3-PBS capture and 84344-2-PBS detection (validated in Cytometric bead array)

MP01220-2: 84344-4-PBS capture and 84344-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35749

Product name: Recombinant human EPPK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1400-1570 aa of NM_031308.3

Sequence: NKFFFDPSARDQVTYQQLRERCVCDSETGLLLLPLPSDTVLEVDDHTAVALRAMKVPVSTGRFKGCSVSLWDLLLSEYVGADKRRELVALCRSGRAAALRQVVSAVTTLVEAAERQPLQATFRGLRKQVSARDLFRAQLISRKTLDELSQGTTTVKEVAEMDSVKRSLEGG

Predict reactive species
Full Name epiplakin 1
Calculated Molecular Weight555 kDa
Observed Molecular Weight500-600 kDa
GenBank Accession NumberNM_031308.3
Gene Symbol EPPK1
Gene ID (NCBI) 83481
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP58107
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Epplakin 1 (EPPK1), belonging to the plakin family, is involved in connecting intermediate filaments and regulating their reorganization in stress response. Studies have shown that EPPK1 is involved in the progression of various cancers, such as liver cancer, cervical cancer, and bladder urothelial carcinoma.

Loading...
||
New chat Able
正在加载,请稍候...