Tested Applications
| Positive IF/ICC detected in | HCT 116 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:125-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84372-5-RR targets IKKA in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag26573 Product name: Recombinant human CHUK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 516-620 aa of NM_001278 Sequence: MEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIID Predict reactive species |
| Full Name | conserved helix-loop-helix ubiquitous kinase |
| Calculated Molecular Weight | 85 kDa |
| GenBank Accession Number | NM_001278 |
| Gene Symbol | IKK Alpha |
| Gene ID (NCBI) | 1147 |
| RRID | AB_3671908 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | O15111 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NF‐κB is regulated by phosphorylation of one of its cytoplasmic inhibitors, IκB, mediated by IκB kinases (IKK), allowing NF‐κB nuclear translocation and transcriptional activation. IKKα‐IKKβ heterodimer complexes regulate the DNA binding proteins implicated in the canonical NF‐κB pathway, including p50‐p65, while IKKα‐homodimers regulate p52‐RELB dimers implicated in the alternative NF‐κB pathway. (PMID: 34187082)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IKKA antibody 84372-5-RR | Download protocol |
| IF protocol for IKKA antibody 84372-5-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





