Use Able AI chat for product recommendations

Mouse Galectin-3 Recombinant monoclonal antibody, PBS Only (Detector)

Galectin-3 Uni-rAb® Recombinant Antibody for IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 84889-3-PBS
Clone No.242453H8

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Gal-3, Lgals3, 35 kDa lectin

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84889-3-PBS targets Galectin-3 as part of a matched antibody pair:

MP01641-1: 84889-2-PBS capture and 84889-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1232

Product name: Recombinant Mouse Galectin-3 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: N-6*His

Domain: 1-264 aa of

Sequence: MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI

Predict reactive species
Full Name lectin, galactose binding, soluble 3
Calculated Molecular Weight28 kDa
Gene Symbol Lgals3
Gene ID (NCBI) 16854
RRIDAB_3743813
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP16110
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-3, a member of the β-galactoside-binding proteins, contains one carbohydrate recognition domain (CRD) and a proline- and glycine-rich N-terminal domain through which is able to form oligomers (PMID: 14758078). Galectin-3 is widely expressed in many normal tissues and a variety of tumors. It is found intracellularly in nucleus and cytoplasm or secreted outside of cell, being present on the cell surface or in the extracellular space (PMID: 16478649). Galectin-3 is involved in various biological processes including cell growth, adhesion, differentiation, apoptosis, angiogenesis, immune response, neoplastic transformation and metastasis (PMID: 16478649; 14758078).

Loading...
||
New chat

Able

正在加载,请稍候...