Tested Applications
| Positive WB detected in | human placenta tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:10000-1:40000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85182-1-RR targets Glycophorin A/CD235a in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2336 Product name: Recombinant Human Glycophorin A protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-91 aa of BC005319 Sequence: SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE Predict reactive species |
| Full Name | glycophorin A (MNS blood group) |
| Calculated Molecular Weight | 150 aa, 16 kDa |
| Observed Molecular Weight | 35-38 kDa |
| GenBank Accession Number | BC005319 |
| Gene Symbol | Glycophorin A |
| Gene ID (NCBI) | 2993 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P02724 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glycophorin A (GYPA), also known as CD235a, is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). Glycophorin A represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Glycophorin A/CD235a antibody 85182-1-RR | Download protocol |
| WB protocol for Glycophorin A/CD235a antibody 85182-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





