Glycophorin A/CD235a Recombinant monoclonal antibody, PBS Only (Capture)

Glycophorin A/CD235a Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 85182-1-PBS
Clone No.242822C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Glycophorin A, 242822C9, CD235a, Glycophorin-A, GPA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85182-1-PBS targets Glycophorin A/CD235a as part of a matched antibody pair:

MP01888-2: 85182-1-PBS capture and 85182-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2336

Product name: Recombinant Human Glycophorin A protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 20-91 aa of BC005319

Sequence: SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE

Predict reactive species
Full Name glycophorin A (MNS blood group)
Calculated Molecular Weight 150 aa, 16 kDa
Observed Molecular Weight35-38 kDa
GenBank Accession NumberBC005319
Gene Symbol Glycophorin A
Gene ID (NCBI) 2993
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02724
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Glycophorin A (GYPA), also known as CD235a, is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). Glycophorin A represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702)

Loading...
||
New chat

Able

正在加载,请稍候...