Product Information
85883-6-PBS targets LGALS3BP as part of a matched antibody pair:
MP02172-3: 85883-7-PBS capture and 85883-6-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg3302 Product name: Recombinant Human LGALS3BP protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 19-140 aa of NM_005567 Sequence: VNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELS Predict reactive species |
| Full Name | lectin, galactoside-binding, soluble, 3 binding protein |
| Calculated Molecular Weight | 585 aa, 65 kDa |
| GenBank Accession Number | NM_005567 |
| Gene Symbol | LGALS3BP |
| Gene ID (NCBI) | 3959 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q08380 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |









