Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, K-562 cells, Jurkat cells, Raji cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86075-1-RR targets PCNP in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag30951 Product name: Recombinant human PCNP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC013916 Sequence: MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKI Predict reactive species |
| Full Name | PEST proteolytic signal containing nuclear protein |
| Calculated Molecular Weight | 19 kDa |
| Observed Molecular Weight | 24-28 kDa |
| GenBank Accession Number | BC013916 |
| Gene Symbol | PCNP |
| Gene ID (NCBI) | 57092 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8WW12 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PCNP antibody 86075-1-RR | Download protocol |
| IHC protocol for PCNP antibody 86075-1-RR | Download protocol |
| WB protocol for PCNP antibody 86075-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









