CoraLite® Plus 647-conjugated PCNP Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL647-86075

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 647 PCNP antibody (CL647-86075, Clone: 250576B6 ) at dilution of 1:200, CL488-phalloidin (green).

PCNP Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL647-86075

Clone No.250576B6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

PEST proteolytic signal-containing nuclear protein, PEST-containing nuclear protein

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-86075 targets PCNP in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30951

  Product name: Recombinant human PCNP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-68 aa of BC013916

  Sequence: MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKI

• Full Name: PEST proteolytic signal containing nuclear protein
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 24-28 kDa
• GenBank Accession Number: BC013916
• Gene Symbol: PCNP
• Gene ID (NCBI): 57092
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WW12
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.