Product Information
86336-1-PBS targets ZnT4 as part of a matched antibody pair:
MP02364-1: 86336-2-PBS capture and 86336-1-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Recombinant | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag3313 Product name: Recombinant human SLC30A4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC026089 Sequence: MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPERPVNGAHPTLQADDDSLLDQDLPLTNSQLSLKVDSCDNCSKQREILKQRKVKARLTIAAVL Predict reactive species | 
                                    
| Full Name | solute carrier family 30 (zinc transporter), member 4 | 
| Calculated Molecular Weight | 429 aa, 47 kDa | 
| Observed Molecular Weight | 47 kDa | 
| GenBank Accession Number | BC026089 | 
| Gene Symbol | ZNT4 | 
| Gene ID (NCBI) | 7782 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | O14863 | 
| Storage Buffer | PBS only, pH 7.3. | 
| Storage Conditions | Store at -80°C. | 
Background Information
ZnT4, also known as SLC30A4, belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. ZnT4 transports Zn into the trans-Golgi apparatus for lactose synthesis, and across the apical cell membrane for efflux from MECs into milk. ZnT4 is expressed in numerous tissues and is enriched in the prostate. ZnT4 encodes a protein with a molecular weight of 47 kDa (PMID: 26538236).









