ZnT4 Recombinant monoclonal antibody, PBS Only (Detector)

ZnT4 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 86336-1-PBS
Clone No.250909D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

SLC30A4, Probable proton-coupled zinc antiporter SLC30A4, ZnT 4, ZnT-4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86336-1-PBS targets ZnT4 as part of a matched antibody pair:

MP02364-1: 86336-2-PBS capture and 86336-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3313

Product name: Recombinant human SLC30A4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-120 aa of BC026089

Sequence: MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPERPVNGAHPTLQADDDSLLDQDLPLTNSQLSLKVDSCDNCSKQREILKQRKVKARLTIAAVL

Predict reactive species
Full Name solute carrier family 30 (zinc transporter), member 4
Calculated Molecular Weight 429 aa, 47 kDa
Observed Molecular Weight47 kDa
GenBank Accession NumberBC026089
Gene Symbol ZNT4
Gene ID (NCBI) 7782
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO14863
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ZnT4, also known as SLC30A4, belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. ZnT4 transports Zn into the trans-Golgi apparatus for lactose synthesis, and across the apical cell membrane for efflux from MECs into milk. ZnT4 is expressed in numerous tissues and is enriched in the prostate. ZnT4 encodes a protein with a molecular weight of 47 kDa (PMID: 26538236).

Loading...
||
New chat

Able

正在加载,请稍候...