Filter: AllWBIHCIF/ICC

WB analysis of HEK-293T using 86607-3-RR
Non-transfected and rat CCL20-transfected HEK-293T cells were subjected to SDS PAGE followed by western blot with 86607-3-RR (CCL20/MIP-3 alpha antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
IHC staining of rat liver using 86607-3-RR
Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 86607-3-RR (CCL20/MIP-3 alpha antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat liver using 86607-3-RR
Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 86607-3-RR (CCL20/MIP-3 alpha antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat colon using 86607-3-RR
Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 86607-3-RR (CCL20/MIP-3 alpha antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat colon using 86607-3-RR
Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 86607-3-RR (CCL20/MIP-3 alpha antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of Transfected CHO-K1 using 86607-3-RR
Immunofluorescent analysis of (4% PFA) fixed Transfected CHO-K1 using CCL20/MIP-3 alpha antibody (86607-3-RR, Clone: 250116E12 ) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

CCL20/MIP-3 alpha Recombinant monoclonal antibody

Name: CCL20/MIP-3 alpha Recombinant monoclonal antibody
Brand: Proteintech
SKU: 86607-3-RR

CCL20/MIP-3 alpha Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 86607-3-RR

Clone No.250116E12

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Beta-chemokine exodus-1, CC chemokine LARC, CC chemokine ST38, C-C motif chemokine 20, CCL 20

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Transfected with Rat CCL20/MIP-3 alpha HEK-293T cells
Positive IHC detected in	rat liver tissue, rat colon tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	Transfected CHO-K1

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86607-3-RR targets CCL20/MIP-3 alpha in WB, IHC, IF/ICC, ELISA applications and shows reactivity with rat samples.

Tested Reactivity	rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg3237 Product name: Recombinant Rat CCL20/MIP-3 alpha protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 27-96 aa of NM_019233.1 Sequence: SNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM Predict reactive species
Full Name	chemokine (C-C motif) ligand 20
Calculated Molecular Weight	11 kDa
GenBank Accession Number	NM_019233.1
Gene Symbol	Ccl20
Gene ID (NCBI)	29538
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P97884
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCL20, also known as macrophage inﬁltrating factor protein 3α, is a C-C chemokine that speciﬁcally binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta.

Protocols

Product Specific Protocols
IF protocol for CCL20/MIP-3 alpha antibody 86607-3-RR	Download protocol
IHC protocol for CCL20/MIP-3 alpha antibody 86607-3-RR	Download protocol
WB protocol for CCL20/MIP-3 alpha antibody 86607-3-RR	Download protocol