Product Information
86977-4-PBS targets Calponin as part of a matched antibody pair:
MP02782-1: 86977-5-PBS capture and 86977-4-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag21384 Product name: Recombinant human Calponin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 225-265 aa of BC022015 Sequence: KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR Predict reactive species |
| Full Name | calponin 1, basic, smooth muscle |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC022015 |
| Gene Symbol | Calponin |
| Gene ID (NCBI) | 1264 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P51911 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). CNN1 is a basic 34-kDa protein specifically expressed in smooth muscle and a marker of smooth muscle cell differentiation.
