Tested Applications
| Positive FC (Intra) detected in | Transfected HEK-293T cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
98464-1-RR targets CCL11/Eotaxin in FC (Intra) applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2400 Product name: recombinant mouse Ccl11 protein Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-97 aa of NM_011330 Sequence: HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 11 |
| Calculated Molecular Weight | 11kd |
| GenBank Accession Number | NM_011330 |
| Gene Symbol | Ccl11 |
| Gene ID (NCBI) | 20292 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P48298 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2 - 8°C. Stable for one year after shipment. |
Background Information
CCL11 also named Eotaxin-1, was initially discovered as an eosinophil-specific chemoattractant. CCL11 plays a central role in both allergic and non-allergic inflammatory reactions by recruiting immune cells such as eosinophils,basophils and Th2 lymphocytes. CCL11 binds to the chemokine receptors CCR2, CCR3 and CCR5, with highest affinity to CCR3. High levels of CCL11 have been described in several chronic inflammatory diseases, such as allergic rhinitis, atopic dermatitis, asthma, gastrointestinal disease and rheumatoid arthritis.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CCL11/Eotaxin antibody 98464-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



