ABL1 Monoclonal antibody, PBS Only

ABL1 Monoclonal Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 68254-1-PBS
Clone No.1E7A5

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

c ABL, 1E7A5, Abelson tyrosine-protein kinase 1, ABL, EC:2.7.10.2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68254-1-PBS targets ABL1 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26152

Product name: Recombinant human ABL1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 801-900 aa of NM_005157

Sequence: MIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP

Predict reactive species
Full Name c-abl oncogene 1, receptor tyrosine kinase
Calculated Molecular Weight 123 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberNM_005157
Gene Symbol ABL1
Gene ID (NCBI) 25
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP00519
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ABL1, also named as ABL, JTK7, c-ABL and p150, belongs to the protein kinase superfamily, Tyr protein kinase family and ABL subfamily. ABL1 regulates cytoskeleton remodeling during cell differentiation, cell division and cell adhesion. ABL1 localizes to dynamic actin structures, and phosphorylates CRK and CRKL, DOK1, and other proteins controlling cytoskeleton dynamics. It regulates DNA repair potentially by activating the proapoptotic pathway when the DNA damage is too severe to be repaired. ABL1 catalyze the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. A chromosomal aberration involving ABL1 is a cause of chronic myeloid leukemia (CML) [MIM:608232]. Translocation t(9;22)(q34;q11) with BCR. The translocation produces a BCR-ABL found also in acute myeloid leukemia (AML) and acute lymphoblastic leukemia (ALL). The antibody is specific to ABL1.

Loading...
||
New chat Able
正在加载,请稍候...