ABR Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84011-6-RR (same clone as 84011-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84011-6-RR (ABR antibody) at dilution of 1:12000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84011-6-PBS in a different storage buffer formulation.

• 

  WB analysis using 84011-6-RR (same clone as 84011-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84011-6-RR (ABR antibody) at dilution of 1:12000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84011-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84011-6-RR

  Biolayer interferometry (BLl) kinetic assays of 84011-6-RR against Human ABR were performed. The affinity constant is 4.96 nM.

ABR Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84011-6-PBS

Clone No.241121G1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

MDB, active BCR related gene, 241121G1

---

Product Information

84011-6-PBS targets ABR in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29522

  Product name: Recombinant human ABR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-87 aa of NM_021962

  Sequence: MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK

• Full Name: active BCR-related gene
• Calculated Molecular Weight: 98 kDa
• Observed Molecular Weight: 97-100 kDa
• GenBank Accession Number: NM_021962
• Gene Symbol: ABR
• Gene ID (NCBI): 29
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q12979
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ABR (Active breakpoint cluster region-related protein) is the only protein known in humans and mice to share high homology with BCR (68% amino acid identity). BCR(Breakpoint cluster region) gene was originally identified due to its involvement in a specific chromosomal translocation that causes the development of chronic myeloid leukemia and a subset of acute lymphoblastic leukemia. The C-terminus is a GTPase-activating protein domain which stimulates GTP hydrolysis by RAC1, RAC2 and CDC42. (PMID: 17116687, PMID: 37507586)