Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, PK-15 cells, HepG2 cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | mouse skeletal muscle tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 7 publications below |
| WB | See 179 publications below |
| IHC | See 15 publications below |
| IF | See 10 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
| RIP | See 1 publications below |
Product Information
21923-1-AP targets ACC1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, chicken, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16452 Product name: Recombinant human ACC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2260-2383 aa of BC137287 Sequence: LLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST Predict reactive species |
| Full Name | acetyl-Coenzyme A carboxylase alpha |
| Calculated Molecular Weight | 2383 aa, 275 kDa |
| Observed Molecular Weight | 250 kDa |
| GenBank Accession Number | BC137287 |
| Gene Symbol | Acetyl-CoA Carboxylase 1 |
| Gene ID (NCBI) | 31 |
| RRID | AB_11042445 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13085 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ACACA(Acetyl-CoA carboxylase 1, ACC), also named as ACAC, ACC1 and ACCA, belongs to the biotin containing enzyme family. It catalyzes the synthesis of malonyl-CoA, which is an intermediate substrate playing a pivotal role in the regulation of fatty acid metabolism and energy production. ACACA is involved in the biosynthesis of fatty acids, and malonyl-CoA produced is used as a building block to extend the chain length of fatty acids by fatty acid synthase (FAS)(PMID:19900410). It has 4 isoforms produced by alternative promoter usage with the molecular weight between 260 kDa and 270 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for ACC1 antibody 21923-1-AP | Download protocol |
| IF protocol for ACC1 antibody 21923-1-AP | Download protocol |
| IHC protocol for ACC1 antibody 21923-1-AP | Download protocol |
| IP protocol for ACC1 antibody 21923-1-AP | Download protocol |
| WB protocol for ACC1 antibody 21923-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Cell KMT2C deficiency drives transdifferentiation of double-negative prostate cancer and confer resistance to AR-targeted therapy | ||
Cell Res Mannose antagonizes GSDME-mediated pyroptosis through AMPK activated by metabolite GlcNAc-6P | ||
Signal Transduct Target Ther The AKAP12-PKA axis regulates lipid homeostasis during alcohol-associated liver disease | ||
Cell Metab Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism. | ||
Adv Sci (Weinh) Transcriptional Regulation of De Novo Lipogenesis by SIX1 in Liver Cancer Cells | ||
Autophagy Buddleoside alleviates nonalcoholic steatohepatitis by targeting the AMPK-TFEB signaling pathway |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Kishor (Verified Customer) (02-22-2019) | I have got some good results with this Ab, but the band are not at the exact place (molecular weight) where it supposed to be
![]() |






















