• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated ACC1 Polyclonal antibody

ACC1 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-21923

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IF/ICC, FC (Intra)

ACACA, ACAC, Acetyl CoA carboxylase 1, ACC-alpha, ACCA

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-21923 targets ACC1 in IF/ICC, FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16452

Product name: Recombinant human ACC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2260-2383 aa of BC137287

Sequence: LLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST

Predict reactive species
Full Name acetyl-Coenzyme A carboxylase alpha
Calculated Molecular Weight 2383 aa, 275 kDa
Observed Molecular Weight 260-270 kDa
GenBank Accession NumberBC137287
Gene Symbol Acetyl-CoA Carboxylase 1
Gene ID (NCBI) 31
RRIDAB_2919185
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13085
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ACACA(Acetyl-CoA carboxylase 1, ACC), also named as ACAC, ACC1 and ACCA, belongs to the biotin containing enzyme family. It catalyzes the synthesis of malonyl-CoA, which is an intermediate substrate playing a pivotal role in the regulation of fatty acid metabolism and energy production. ACACA is involved in the biosynthesis of fatty acids, and malonyl-CoA produced is used as a building block to extend the chain length of fatty acids by fatty acid synthase (FAS)(PMID:19900410). It has 4 isoforms produced by alternative promoter usage with the molecular weight between 260 kDa and 270 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ACC1 antibody CL488-21923Download protocol
FC protocol for CL Plus 488 ACC1 antibody CL488-21923Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...