Tested Applications
Positive WB detected in | Jurkat cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL750-82967 targets ACAP1 in WB applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag34309 Product name: Recombinant human ACAP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 163-270 aa of BC018543 Sequence: RAGYRGRALDYALQINVIEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEG Predict reactive species |
Full Name | ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 |
Calculated Molecular Weight | 740 aa, 82 kDa |
Observed Molecular Weight | 82-85 kDa |
GenBank Accession Number | BC018543 |
Gene Symbol | ACAP1 |
Gene ID (NCBI) | 9744 |
RRID | AB_3673755 |
Conjugate | CoraLite® Plus 750 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 755 nm / 780 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q15027 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ACAP1, also named as Centaurin-beta-1, is a 740 amino acid protein, which is expressed Highly in lung and spleen. ACAP1 as a GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6) is required for clathrin-dependent export of proteins from recycling endosomes to trans-Golgi network and cell surface and required for regulated export of ITGB1 from recycling endosomes to the cell surface and ITGB1-dependent cell migration.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CL Plus 750 ACAP1 antibody CL750-82967 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |