Product Information
81656-1-PBS targets ACC1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag16452 Product name: Recombinant human ACC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2260-2383 aa of BC137287 Sequence: LLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST Predict reactive species |
Full Name | acetyl-Coenzyme A carboxylase alpha |
Calculated Molecular Weight | 2383 aa, 275 kDa |
Observed Molecular Weight | 250 kDa |
GenBank Accession Number | BC137287 |
Gene Symbol | Acetyl-CoA Carboxylase 1 |
Gene ID (NCBI) | 31 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q13085 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
ACACA(Acetyl-CoA carboxylase 1, ACC), also named as ACAC, ACC1 and ACCA, belongs to the biotin containing enzyme family. It catalyzes the synthesis of malonyl-CoA, which is an intermediate substrate playing a pivotal role in the regulation of fatty acid metabolism and energy production. ACACA is involved in the biosynthesis of fatty acids, and malonyl-CoA produced is used as a building block to extend the chain length of fatty acids by fatty acid synthase (FAS)(PMID:19900410). It has 4 isoforms produced by alternative promoter usage with the molecular weight between 260 kDa and 270 kDa.