ACC1 Recombinant monoclonal antibody

• 

  WB analysis using 81656-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81656-1-RR (ACC1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 81656-1-RR

  IP result of anti-ACC1 (IP:81656-1-RR, 4ug; Detection:81656-1-RR 1:2000) with HepG2 cells lysate 1640 ug.

• 

  Affinity and Kinetic Characterization of 81656-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81656-1-RR against Human ACC1 were performed. The affinity constant is 2.28 nM.

ACC1 Uni-rAb^® Recombinant Antibody for WB, IP, ELISA

Cat No. 81656-1-RR

Clone No.2I13

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

ACACA, ACC-alpha, ACCA, ACC, ACAC

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, NIH/3T3 cells, C6 cells
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81656-1-RR targets ACC1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16452

  Product name: Recombinant human ACC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2260-2383 aa of BC137287

  Sequence: LLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST

• Full Name: acetyl-Coenzyme A carboxylase alpha
• Calculated Molecular Weight: 2383 aa, 275 kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: BC137287
• Gene Symbol: Acetyl-CoA Carboxylase 1
• Gene ID (NCBI): 31
• RRID: AB_2935570
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13085
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACACA(Acetyl-CoA carboxylase 1, ACC), also named as ACAC, ACC1 and ACCA, belongs to the biotin containing enzyme family. It catalyzes the synthesis of malonyl-CoA, which is an intermediate substrate playing a pivotal role in the regulation of fatty acid metabolism and energy production. ACACA is involved in the biosynthesis of fatty acids, and malonyl-CoA produced is used as a building block to extend the chain length of fatty acids by fatty acid synthase (FAS)(PMID:19900410). It has 4 isoforms produced by alternative promoter usage with the molecular weight between 260 kDa and 270 kDa.